PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr025102.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 306aa    MW: 33223.4 Da    PI: 8.157
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr025102.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.26.7e-44131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p++fanvhk+FGasnv k+l++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lqq+l+q++a+l  +k
  Pbr025102.1  13 PCAACKFLRRKCTPECVFAPYFPPDNPQRFANVHKVFGASNVAKILNELSASQRDDAVNSLAYEAEARLRDPVYGCVGLISLLQQRLKQVQADLFNAK 110
                  7********************************************************************************************98888 PP

       DUF260  99 ee 100
                  +e
  Pbr025102.1 111 KE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.85112113IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4313109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSSSSMSSSS NSPCAACKFL RRKCTPECVF APYFPPDNPQ RFANVHKVFG ASNVAKILNE  60
LSASQRDDAV NSLAYEAEAR LRDPVYGCVG LISLLQQRLK QVQADLFNAK KELATYIGPQ  120
AMLSILQPPT YMAQQLQGNA SSSAGPPYSM SPMMGIPTAA ASGQLMVRDP QQQQQHQQIF  180
EAQQLAAAVA AREQQEMFRS FDQSKQAMQQ QAQDHLSGFT QMAGAVGNAV LPSLALGFDS  240
GPYHQIQPQH PHHNHRHQLQ LQAQLLLQTQ QPQGHHQAQQ SQQPQLQAKP VPGEEGGGRS  300
VGPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366715.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_009366720.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-74LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J81e-131M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_00s1247g00010.t015e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-71ASYMMETRIC LEAVES 2-like 1